Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mbtd1 Peptide - middle region

Mbtd1 Peptide - middle region

Product Specifications

Product Name Alternative

AA408199, AI194990, hemp

UniProt

Q6P5G3

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Mbtd1 Rabbit Polyclonal Antibody (orb581143) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_598773

Preservative

Lyophilized powder

AA Sequence

LVPPRTVQHKYTNWKAFLVKRLTGAKTLPPDFSQKVSESMQYPFKPCMRV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ATRN Polyclonal Antibody
E-AB-16269-01 20 µL

ATRN Polyclonal Antibody

Sign In for Pricing
View Details
ATRN Polyclonal Antibody
E-AB-16269-02 60 µL

ATRN Polyclonal Antibody

Sign In for Pricing
View Details
ATRN Polyclonal Antibody
E-AB-16269-03 120 µL

ATRN Polyclonal Antibody

Sign In for Pricing
View Details
ATRN Polyclonal Antibody
E-AB-16269-04 200 µL

ATRN Polyclonal Antibody

Sign In for Pricing
View Details
Hepatocyte Specific (CPS1/1022), Biotin conjugate, 0.1mg/mL
BNCB1022-100 1x 100 µL

Hepatocyte Specific (CPS1/1022), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin, Basic (Type II or HMW) (Epithelial Marker) (KRTH/1576R), CF405S conjugate, 0.1mg/mL
BNC041576-500 1x 500 µL

Cytokeratin, Basic (Type II or HMW) (Epithelial Marker) (KRTH/1576R), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details