Mbtd1 Peptide - middle region
Mbtd1 Peptide - middle region
Product Specifications
Product Name Alternative
AA408199, AI194990, hemp
UniProt
Q6P5G3
Field of Research
Epigenetics & Chromatin
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with Mbtd1 Rabbit Polyclonal Antibody (orb581143) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_598773
Preservative
Lyophilized powder
AA Sequence
LVPPRTVQHKYTNWKAFLVKRLTGAKTLPPDFSQKVSESMQYPFKPCMRV
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
![UAP56 (DDX39B) Mouse Monoclonal Antibody [Clone ID: OTI8B8]](https://cdn.genprice.uk/products/937/68dd18bb061270361e908ddf/imageurl/cf812670.webp)
CF812670 100 µg
UAP56 (DDX39B) Mouse Monoclonal Antibody [Clone ID: OTI8B8]
Sign In for Pricing
View Details 
![Growth Arrest Specific Protein 7 (GAS7) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI8H10]](https://cdn.genprice.uk/products/937/68dd1b68061270361ea151bf/imageurl/ta501907bm.webp)
TA501907BM 100 µL
Growth Arrest Specific Protein 7 (GAS7) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI8H10]
Sign In for Pricing
View Details 
BNC742058-500 1x 500 µL
HPV-16 (Human Papilloma Virus 16) (HPV16/2058R), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details