Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MCART6 Peptide - middle region

MCART6 Peptide - middle region

Product Specifications

Product Name Alternative

DKFZp686O1267, MCART6

UniProt

Q5H9E4

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MCART6 Rabbit Polyclonal Antibody (orb579237) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001012773

Preservative

Lyophilized powder

AA Sequence

WPVLARNSLGSALYFSFKDPIQDGLAEQGLPHWVPALVSGSVNGTITCLV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit anti-ANKRD20A3 Antibody
DL92465A-01 50 µL

Rabbit anti-ANKRD20A3 Antibody

Sign In for Pricing
View Details
Rabbit anti-ANKRD20A3 Antibody
DL92465A-02 100 µL

Rabbit anti-ANKRD20A3 Antibody

Sign In for Pricing
View Details
Spark Red™ 718 anti-human CD27 Recombinant
GT16377 25 Tests

Spark Red™ 718 anti-human CD27 Recombinant

Sign In for Pricing
View Details
Rabbit Polyclonal CDK5RAP1 Antibody
NBP2-92870-0.1mL 0.1 mL

Rabbit Polyclonal CDK5RAP1 Antibody

Sign In for Pricing
View Details
OAAV00265-200UG - PCNA Antibody
OAAV00265-200UG 200µg

OAAV00265-200UG - PCNA Antibody

Sign In for Pricing
View Details
MKKS (McKusick-Kaufman Syndrome, BBS6, HMCS, KMS, MKS)
248778 50 µg

MKKS (McKusick-Kaufman Syndrome, BBS6, HMCS, KMS, MKS)

Sign In for Pricing
View Details