MCART6 Peptide - middle region
MCART6 Peptide - middle region
Product Specifications
Product Name Alternative
DKFZp686O1267, MCART6
UniProt
Q5H9E4
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with MCART6 Rabbit Polyclonal Antibody (orb579237) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_001012773
Preservative
Lyophilized powder
AA Sequence
WPVLARNSLGSALYFSFKDPIQDGLAEQGLPHWVPALVSGSVNGTITCLV
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
abx211666-01 50 µL
Smad Specific E3 Ubiquitin Protein Ligase 2 (SMURF2) Antibody
Sign In for Pricing
View Details abx211666-02 100 µL
Smad Specific E3 Ubiquitin Protein Ligase 2 (SMURF2) Antibody
Sign In for Pricing
View Details 
MBS6173301-01 0.1 mL
AGER (Advanced Glycosylation End Product-Specific Receptor, MGC22357, RAGE) (Biotin)
Sign In for Pricing
View Details