Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MCEE Peptide - C-terminal region

MCEE Peptide - C-terminal region

Product Specifications

Product Name Alternative

GLOD2

UniProt

Q96PE7

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MCEE Rabbit Polyclonal Antibody (orb584642) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_115990

Preservative

Lyophilized powder

AA Sequence

DSPIAGFLQKNKAGGMHHICIEVDNINAAVMDLKKKKIRSLSEEVKIGAH

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

AdmiRa-Off-mmu-miR-8118 Virus
mm6932 1.0 mL

AdmiRa-Off-mmu-miR-8118 Virus

Sign In for Pricing
View Details
EcpE Antibody
orb813516 2 mg

EcpE Antibody

Sign In for Pricing
View Details
Pro-Gastrin Releasing Peptide (ProGRP) Polyclonal Antibody
MBS2032701-01 0.1 mL

Pro-Gastrin Releasing Peptide (ProGRP) Polyclonal Antibody

Sign In for Pricing
View Details
Pro-Gastrin Releasing Peptide (ProGRP) Polyclonal Antibody
MBS2032701-02 0.2 mL

Pro-Gastrin Releasing Peptide (ProGRP) Polyclonal Antibody

Sign In for Pricing
View Details
Pro-Gastrin Releasing Peptide (ProGRP) Polyclonal Antibody
MBS2032701-03 0.5 mL

Pro-Gastrin Releasing Peptide (ProGRP) Polyclonal Antibody

Sign In for Pricing
View Details
Pro-Gastrin Releasing Peptide (ProGRP) Polyclonal Antibody
MBS2032701-04 1 mL

Pro-Gastrin Releasing Peptide (ProGRP) Polyclonal Antibody

Sign In for Pricing
View Details