Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mcm4 Peptide - N-terminal region

Mcm4 Peptide - N-terminal region

Product Specifications

Product Name Alternative

Mcmd4

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Mcm4 Rabbit Polyclonal Antibody (orb576046) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_387500

Preservative

Lyophilized powder

AA Sequence

PLEFDVSSPLTYGTPSSRVEGTPRSGVRGTPMRQRPDLGSARKGLQVDLQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Anti CD36 Polyclonal Affinity Purified (PBS with 0.02% sodium azide, 0.5% BSA and 50% glycerol, pH7.4) (Western Blot,ELISA) 120ul
IRBAMLCD36AP662120UL 120 µL

Rabbit Anti CD36 Polyclonal Affinity Purified (PBS with 0.02% sodium azide, 0.5% BSA and 50% glycerol, pH7.4) (Western Blot,ELISA) 120ul

Sign In for Pricing
View Details
Olfr458 AAV siRNA Pooled Vector
33166164 1.0 µg

Olfr458 AAV siRNA Pooled Vector

Sign In for Pricing
View Details
Fish beta2-Glycoprotein 1 Antibody IgA ELISA Kit
MBS012822 Inquire

Fish beta2-Glycoprotein 1 Antibody IgA ELISA Kit

Sign In for Pricing
View Details
HRP Linked Monoclonal Antibody to High Mobility Group Protein 1 (HMGB1)
MBS2129328-01 0.1 mL

HRP Linked Monoclonal Antibody to High Mobility Group Protein 1 (HMGB1)

Sign In for Pricing
View Details
HRP Linked Monoclonal Antibody to High Mobility Group Protein 1 (HMGB1)
MBS2129328-02 0.2 mL

HRP Linked Monoclonal Antibody to High Mobility Group Protein 1 (HMGB1)

Sign In for Pricing
View Details
HRP Linked Monoclonal Antibody to High Mobility Group Protein 1 (HMGB1)
MBS2129328-03 0.5 mL

HRP Linked Monoclonal Antibody to High Mobility Group Protein 1 (HMGB1)

Sign In for Pricing
View Details