Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mcm4 Peptide - N-terminal region

Mcm4 Peptide - N-terminal region

Product Specifications

Product Name Alternative

Mcmd4

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Mcm4 Rabbit Polyclonal Antibody (orb576046) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_387500

Preservative

Lyophilized powder

AA Sequence

PLEFDVSSPLTYGTPSSRVEGTPRSGVRGTPMRQRPDLGSARKGLQVDLQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MEL-di-EG-OPFP
ADC-L-022 Each

MEL-di-EG-OPFP

Sign In for Pricing
View Details
Sft2d3 (NM_026006) Mouse Tagged ORF Clone
MG216153 10 µg

Sft2d3 (NM_026006) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Cytochrome C Recombinant Rabbit mAb, Cy3 conjugated
orb2355831 100 µL

Cytochrome C Recombinant Rabbit mAb, Cy3 conjugated

Sign In for Pricing
View Details
SSTR2 Antibody
A35706-50UG 50 µg

SSTR2 Antibody

Sign In for Pricing
View Details
Rabbit Polyclonal PARP11 Antibody
NBP1-88394 0.1 mL

Rabbit Polyclonal PARP11 Antibody

Sign In for Pricing
View Details
Atp6v0b 3'UTR Lenti-reporter-Luc Vector
12771084 1.0 µg

Atp6v0b 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details