MCOLN3 Peptide - middle region
MCOLN3 Peptide - middle region
Product Specifications
Product Name Alternative
FLJ11006, FLJ36629, MGC71509, TRP-ML3, TRPML3
UniProt
Q8TDD5
Field of Research
Neuroscience
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with MCOLN3 Rabbit Polyclonal Antibody (orb576381) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_060768
Preservative
Lyophilized powder
AA Sequence
ENKLNLTLDFHRLLTVELQFKLKAINLQTVRHQELPDCYDFTLTITFDNK
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
TL511250V 500 µL Each
4933421B21Rik Mouse shRNA Lentiviral Particle (Locus ID 71074)
Sign In for Pricing
View Details 
bs-4999R-RBITC-02 100 µL
RAGE Polyclonal Antibody, RBITC Conjugated
Sign In for Pricing
View Details ![N-Methyl-2-[[3-[ (1E) -2- (2-pyridinyl) ethenyl]-1- (tetrahydro-2H-pyran-2-yl) -1H-indazol-6-yl]thio]benzamide](https://cdn.genprice.uk/genprice/uk/genprice3.webp)
OR1059297-01 100 mg
N-Methyl-2-[[3-[ (1E) -2- (2-pyridinyl) ethenyl]-1- (tetrahydro-2H-pyran-2-yl) -1H-indazol-6-yl]thio]benzamide
Sign In for Pricing
View Details OR1059297-02 250 mg
N-Methyl-2-[[3-[ (1E) -2- (2-pyridinyl) ethenyl]-1- (tetrahydro-2H-pyran-2-yl) -1H-indazol-6-yl]thio]benzamide
Sign In for Pricing
View Details OR1059297-03 1 g
N-Methyl-2-[[3-[ (1E) -2- (2-pyridinyl) ethenyl]-1- (tetrahydro-2H-pyran-2-yl) -1H-indazol-6-yl]thio]benzamide
Sign In for Pricing
View Details