Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MCOLN3 Peptide - middle region

MCOLN3 Peptide - middle region

Product Specifications

Product Name Alternative

FLJ11006, FLJ36629, MGC71509, TRP-ML3, TRPML3

UniProt

Q8TDD5

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MCOLN3 Rabbit Polyclonal Antibody (orb576381) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_060768

Preservative

Lyophilized powder

AA Sequence

ENKLNLTLDFHRLLTVELQFKLKAINLQTVRHQELPDCYDFTLTITFDNK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rasa2 (NM_001105724) Rat Tagged ORF Clone Lentiviral Particle
RR203256L4V 200 µL

Rasa2 (NM_001105724) Rat Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
DYT10 3'UTR Lenti-reporter-Luc Vector
18782081 1.0 µg

DYT10 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
Human Collagen Type Iv (Col Iv) Elisa Kit
EKC33226 96 Tests

Human Collagen Type Iv (Col Iv) Elisa Kit

Sign In for Pricing
View Details
Rabbit Polyclonal PEX14 Antibody [Janelia Fluor 646]
NBP1-71841JF646 0.1 mL

Rabbit Polyclonal PEX14 Antibody [Janelia Fluor 646]

Sign In for Pricing
View Details
Cystatin C Blocking Peptide
MBS8210440-01 1 mg

Cystatin C Blocking Peptide

Sign In for Pricing
View Details
Cystatin C Blocking Peptide
MBS8210440-02 5 mg

Cystatin C Blocking Peptide

Sign In for Pricing
View Details