Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MDK Peptide - C-terminal region

MDK Peptide - C-terminal region

Product Specifications

Product Name Alternative

FLJ27379, MK, NEGF2

UniProt

P21741

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MDK Rabbit Polyclonal Antibody (orb585639) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_002382

Preservative

Lyophilized powder

AA Sequence

CDGGTGTKVRQGTLKKARYNAQCQETIRVTKPCTPKTKAKAKAKKGKGKD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Glutathione S Transferase Pi (GSTp) ELISA Kit
MBS454798-01 48 Tests

Human Glutathione S Transferase Pi (GSTp) ELISA Kit

Sign In for Pricing
View Details
Human Glutathione S Transferase Pi (GSTp) ELISA Kit
MBS454798-02 96 Tests

Human Glutathione S Transferase Pi (GSTp) ELISA Kit

Sign In for Pricing
View Details
Human Glutathione S Transferase Pi (GSTp) ELISA Kit
MBS454798-03 5x 96 Tests

Human Glutathione S Transferase Pi (GSTp) ELISA Kit

Sign In for Pricing
View Details
Human Glutathione S Transferase Pi (GSTp) ELISA Kit
MBS454798-04 10x 96 Tests

Human Glutathione S Transferase Pi (GSTp) ELISA Kit

Sign In for Pricing
View Details
Rabbit Polyclonal ZBTB2 Antibody
NBP1-88789-25ul 25 µL

Rabbit Polyclonal ZBTB2 Antibody

Sign In for Pricing
View Details
Recombinant Bacillus thuringiensis subsp. konkukian Germination protease (gpr)
MBS1468654-01 0.02 mg (E-Coli)

Recombinant Bacillus thuringiensis subsp. konkukian Germination protease (gpr)

Sign In for Pricing
View Details