Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MECR Peptide - C-terminal region

MECR Peptide - C-terminal region

Product Specifications

Product Name Alternative

CGI-63, FASN2B, NRBF1

UniProt

Q9BV79

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MECR Rabbit Polyclonal Antibody (orb585131) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_057095

Preservative

Lyophilized powder

AA Sequence

AKQPVVASVSLLIFKDLKLRGFWLSQWKKDHSPDQFKELILTLCDLIRRG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human mtTFA (TFAM) activation kit by CRISPRa
GA104828 1 Kit

Human mtTFA (TFAM) activation kit by CRISPRa

Sign In for Pricing
View Details
MMP3 (Marker of Metastasis and Rheumatoid Arthritis) (MMP3/2655), CF647 conjugate, 0.1mg/mL
BNC472655-100 1x 100 µL

MMP3 (Marker of Metastasis and Rheumatoid Arthritis) (MMP3/2655), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human STPG4 activation kit by CRISPRa
GA117190 1 Kit

Human STPG4 activation kit by CRISPRa

Sign In for Pricing
View Details
Pseudomonas aeruginosa serotype 6C (1200/472), Biotin conjugate, 0.1mg/mL
BNCB0240-500 1x 500 µL

Pseudomonas aeruginosa serotype 6C (1200/472), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Atp8b2 Mouse Gene Knockout Kit (CRISPR)
KN501834 1 Kit

Atp8b2 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
ALKBH1 (N-term) Rabbit Polyclonal Antibody
AP46320PU-N 100 µL

ALKBH1 (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details