Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MECR Peptide - C-terminal region

MECR Peptide - C-terminal region

Product Specifications

Product Name Alternative

CGI-63, FASN2B, NRBF1

UniProt

Q9BV79

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MECR Rabbit Polyclonal Antibody (orb585131) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_057095

Preservative

Lyophilized powder

AA Sequence

AKQPVVASVSLLIFKDLKLRGFWLSQWKKDHSPDQFKELILTLCDLIRRG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Plasmalemma Vesicle Associated Protein (PLVAP) ELISA Kit
RDR-PLVAP-Hu-01 96 Tests

Human Plasmalemma Vesicle Associated Protein (PLVAP) ELISA Kit

Sign In for Pricing
View Details
Human Plasmalemma Vesicle Associated Protein (PLVAP) ELISA Kit
RDR-PLVAP-Hu-02 48 Tests

Human Plasmalemma Vesicle Associated Protein (PLVAP) ELISA Kit

Sign In for Pricing
View Details
Frozen Tissue Blocks, Endometrium
CB508842 1 Block

Frozen Tissue Blocks, Endometrium

Sign In for Pricing
View Details
Akr1b10 Mouse Gene Knockout Kit (CRISPR)
KN501083 1 Kit

Akr1b10 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
MAGEB18 (NM_173699) Human Recombinant Protein
TP306329 20 µg

MAGEB18 (NM_173699) Human Recombinant Protein

Sign In for Pricing
View Details
SPANXE Human Gene Knockout Kit (CRISPR)
KN402803 1 Kit

SPANXE Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details