Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MED14 Peptide - middle region

MED14 Peptide - middle region

Product Specifications

Product Name Alternative

CRSP150, CRSP2, CSRP, CXorf4, DRIP150, EXLM1, MGC104513, RGR1, TRAP170

UniProt

O60244

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MED14 Rabbit Polyclonal Antibody (orb583889) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

ChIP, WB

NCBI Accession Number

NP_004220

Preservative

Lyophilized powder

AA Sequence

AADREDSPAMALLLQQFKENIQDLVFRTKTGKQTRTNAKRKLSDDPCPVE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DAZAP2 Rabbit Polyclonal Antibody
TA375329 100 µL

DAZAP2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Tissue FFPE Sections, Cervix
CS705710 5x 5 µm

Tissue FFPE Sections, Cervix

Sign In for Pricing
View Details
ROS1 Mouse Monoclonal Antibody [Clone ID: OTI1E6]
CF805843 100 µg

ROS1 Mouse Monoclonal Antibody [Clone ID: OTI1E6]

Sign In for Pricing
View Details
Tau (Ab-205) Antibody
8B7245-AAT 50 µg

Tau (Ab-205) Antibody

Sign In for Pricing
View Details
Biotin-16-dUTP, Lyophilized Powder
#40022-1 1x 50 µg

Biotin-16-dUTP, Lyophilized Powder

Sign In for Pricing
View Details
Human MIDN activation kit by CRISPRa
GA113968 1 Kit

Human MIDN activation kit by CRISPRa

Sign In for Pricing
View Details