Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MED14 Peptide - middle region

MED14 Peptide - middle region

Product Specifications

Product Name Alternative

CRSP150, CRSP2, CSRP, CXorf4, DRIP150, EXLM1, MGC104513, RGR1, TRAP170

UniProt

O60244

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MED14 Rabbit Polyclonal Antibody (orb583889) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

ChIP, WB

NCBI Accession Number

NP_004220

Preservative

Lyophilized powder

AA Sequence

AADREDSPAMALLLQQFKENIQDLVFRTKTGKQTRTNAKRKLSDDPCPVE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NOTCH3 Human Gene Knockout Kit (CRISPR)
KN224711BN 1 Kit

NOTCH3 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Isatuximab Biosimilar - Research Grade
ICH5028-100mg 100 mg

Isatuximab Biosimilar - Research Grade

Sign In for Pricing
View Details
Ferritin, Light Chain (FTL) (Microglia Marker) (FTL/1386), Biotin conjugate, 0.1mg/mL
BNCB1386-500 1x 500 µL

Ferritin, Light Chain (FTL) (Microglia Marker) (FTL/1386), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Large Capacity Water Purification System BCPS-417
BCPS-417 1 Unit

Large Capacity Water Purification System BCPS-417

Sign In for Pricing
View Details
Mouse Shox2 activation kit by CRISPRa
GA203886 1 Kit

Mouse Shox2 activation kit by CRISPRa

Sign In for Pricing
View Details
INCA1 Human Gene Knockout Kit (CRISPR)
KN417947 1 Kit

INCA1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details