Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MED18 Peptide - middle region

MED18 Peptide - middle region

Product Specifications

Product Name Alternative

FLJ20045, p28b

UniProt

Q9BUE0

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MED18 Rabbit Polyclonal Antibody (orb585231) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_060108

Preservative

Lyophilized powder

AA Sequence

PWHLRYLGQPEMGDKNRHALVRNCVDIATSENLTDFLMEMGFRMDHEFVA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human NOP9 Knockout A549 cell line
GTR15410738 1 Vial

Human NOP9 Knockout A549 cell line

Sign In for Pricing
View Details
COG6 shRNA (h) Lentiviral Particles
sc-105224-V 200 µL

COG6 shRNA (h) Lentiviral Particles

Sign In for Pricing
View Details
IMPDH1 discontinued
390509 200 µL

IMPDH1 discontinued

Sign In for Pricing
View Details
GRK 2 (V678) polyclonal antibody
BS3762 50ul

GRK 2 (V678) polyclonal antibody

Sign In for Pricing
View Details
Lentiviral mouse Cacng8 shRNA (UAS) - Lentiviral mouse Cacng8 shRNA (UAS, iRFP) (100)
GTR15246459 1 Vial

Lentiviral mouse Cacng8 shRNA (UAS) - Lentiviral mouse Cacng8 shRNA (UAS, iRFP) (100)

Sign In for Pricing
View Details
Chicken Cytokine IFN Alpha Recombinant
MBS136334-01 0.005 mg

Chicken Cytokine IFN Alpha Recombinant

Sign In for Pricing
View Details