MED18 Peptide - middle region
MED18 Peptide - middle region
Product Specifications
Product Name Alternative
FLJ20045, p28b
UniProt
Q9BUE0
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with MED18 Rabbit Polyclonal Antibody (orb585231) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_060108
Preservative
Lyophilized powder
AA Sequence
PWHLRYLGQPEMGDKNRHALVRNCVDIATSENLTDFLMEMGFRMDHEFVA
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
VAng-Wyb3364-50gEcoli 50 µg (E. coli)
Recombinant HPV-61 L2 (aa 1-459) Protein
Sign In for Pricing
View Details 
SC118610 10 µg
Myosin Phosphatase (PPP1R12A) (NM_002480) Human Untagged Clone
Sign In for Pricing
View Details 
MBS6170888-01 0.1 mL
CDC2 (Cell Division Cycle 2, G1 to S and G2 to M, CDC28A, CDK1, DKFZp686L20222, MGC111195) (Biotin)
Sign In for Pricing
View Details MBS6170888-02 5x 0.1 mL
CDC2 (Cell Division Cycle 2, G1 to S and G2 to M, CDC28A, CDK1, DKFZp686L20222, MGC111195) (Biotin)
Sign In for Pricing
View Details