Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Med19 Peptide - N-terminal region

Med19 Peptide - N-terminal region

Product Specifications

Product Name Alternative

RGD1311926, Med19

UniProt

D3ZAP1

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Med19 Rabbit Polyclonal Antibody (orb582813) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001101211

Preservative

Lyophilized powder

AA Sequence

MRELPGSTELTGSTNLITHYNLEQAYNKFCGKKVKEKLSNFLPDLPGMID

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Guinea pig AP-2 complex subunit sigma (AP2S1) ELISA Kit
MBS7248896-01 48 Well

Guinea pig AP-2 complex subunit sigma (AP2S1) ELISA Kit

Sign In for Pricing
View Details
Guinea pig AP-2 complex subunit sigma (AP2S1) ELISA Kit
MBS7248896-02 96 Well

Guinea pig AP-2 complex subunit sigma (AP2S1) ELISA Kit

Sign In for Pricing
View Details
Guinea pig AP-2 complex subunit sigma (AP2S1) ELISA Kit
MBS7248896-03 5x 96 Well

Guinea pig AP-2 complex subunit sigma (AP2S1) ELISA Kit

Sign In for Pricing
View Details
Guinea pig AP-2 complex subunit sigma (AP2S1) ELISA Kit
MBS7248896-04 10x 96 Well

Guinea pig AP-2 complex subunit sigma (AP2S1) ELISA Kit

Sign In for Pricing
View Details
SPEG discontinued
542507-01 30ul

SPEG discontinued

Sign In for Pricing
View Details
SPEG discontinued
542507-02 100 µL

SPEG discontinued

Sign In for Pricing
View Details