Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MED21 Peptide - C-terminal region

MED21 Peptide - C-terminal region

Product Specifications

Product Name Alternative

SRB7, SURB7

UniProt

Q13503

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MED21 Rabbit Polyclonal Antibody (orb575596) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_004255

Preservative

Lyophilized powder

AA Sequence

EENHEAATCLEDVVYRGDMLLEKIQSALADIAQSQLKTRSGTHSQSLPDS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Gadobutrol Impurity 157
RM-G040357-01 10 mg

Gadobutrol Impurity 157

Sign In for Pricing
View Details
Gadobutrol Impurity 157
RM-G040357-02 25 mg

Gadobutrol Impurity 157

Sign In for Pricing
View Details
Gadobutrol Impurity 157
RM-G040357-03 50 mg

Gadobutrol Impurity 157

Sign In for Pricing
View Details
Gadobutrol Impurity 157
RM-G040357-04 100 mg

Gadobutrol Impurity 157

Sign In for Pricing
View Details
Rabbit Polyclonal C20orf196 Antibody
NBP1-82062 0.1 mL

Rabbit Polyclonal C20orf196 Antibody

Sign In for Pricing
View Details
FZD6 Adenovirus (Mouse)
21113054 1.0 mL

FZD6 Adenovirus (Mouse)

Sign In for Pricing
View Details