Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MED21 Peptide - C-terminal region

MED21 Peptide - C-terminal region

Product Specifications

Product Name Alternative

SRB7, SURB7

UniProt

Q13503

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MED21 Rabbit Polyclonal Antibody (orb575596) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_004255

Preservative

Lyophilized powder

AA Sequence

EENHEAATCLEDVVYRGDMLLEKIQSALADIAQSQLKTRSGTHSQSLPDS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Buffered Tryptone Glucose Yeast Extract Broth
M951-500G 500 g

Buffered Tryptone Glucose Yeast Extract Broth

Sign In for Pricing
View Details
MONO-MAC-1 Cell Line
CSC-C0353 One Frozen Vial

MONO-MAC-1 Cell Line

Sign In for Pricing
View Details
ETFB (Electron Transfer Flavoprotein Subunit beta, MADD, FP585) (APC)
MBS6416421-01 0.1 mL

ETFB (Electron Transfer Flavoprotein Subunit beta, MADD, FP585) (APC)

Sign In for Pricing
View Details
ETFB (Electron Transfer Flavoprotein Subunit beta, MADD, FP585) (APC)
MBS6416421-02 5x 0.1 mL

ETFB (Electron Transfer Flavoprotein Subunit beta, MADD, FP585) (APC)

Sign In for Pricing
View Details
AZGP1 siRNA Oligos set (Human)
12907171 3x 5 nmol

AZGP1 siRNA Oligos set (Human)

Sign In for Pricing
View Details
5T4 Rabbit Monoclonal Antibody
E56G0789 100 µL

5T4 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details