Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Med21 Peptide - N-terminal region

Med21 Peptide - N-terminal region

Product Specifications

Product Name Alternative

0610007L03Rik, AI449604, D19234, D6Ertd782e, Srb7, Surb7

UniProt

Q9CQ39

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Med21 Rabbit Polyclonal Antibody (orb575597) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

ChIP, WB

NCBI Accession Number

NP_079591

Preservative

Lyophilized powder

AA Sequence

FCNAIGVLQQCGPPASFSNIQTAINKDQPANPTEEYAQLFAALIARTAKD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Apolipoprotein E / APOE4 Protein, His Tag (MALS verified)
APE-H52H9-1mg 1 mg

Human Apolipoprotein E / APOE4 Protein, His Tag (MALS verified)

Sign In for Pricing
View Details
RBM3 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)
LV697522 1.0 µg DNA

RBM3 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)

Sign In for Pricing
View Details
ALPP Mouse Monoclonal Antibody (Fluoro594)
orb3085117 100 µg

ALPP Mouse Monoclonal Antibody (Fluoro594)

Sign In for Pricing
View Details
Parp11 3'UTR GFP Stable Cell Line
TU265822 1.0 mL

Parp11 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Mouse Ankef1 Pre-designed siRNA Set A
SI100628A 1 Each

Mouse Ankef1 Pre-designed siRNA Set A

Sign In for Pricing
View Details
MIR675 ORF Vector (Human) (pORF)
ORF025016 1.0 µg DNA

MIR675 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details