Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Med21 Peptide - N-terminal region

Med21 Peptide - N-terminal region

Product Specifications

Product Name Alternative

0610007L03Rik, AI449604, D19234, D6Ertd782e, Srb7, Surb7

UniProt

Q9CQ39

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Med21 Rabbit Polyclonal Antibody (orb575597) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

ChIP, WB

NCBI Accession Number

NP_079591

Preservative

Lyophilized powder

AA Sequence

FCNAIGVLQQCGPPASFSNIQTAINKDQPANPTEEYAQLFAALIARTAKD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse TOB2 shRNA Plasmid
abx974952-01 150 µg

Mouse TOB2 shRNA Plasmid

Sign In for Pricing
View Details
Mouse TOB2 shRNA Plasmid
abx974952-02 300 µg

Mouse TOB2 shRNA Plasmid

Sign In for Pricing
View Details
Guinea Pig Pancreastatin ELISA kit
GTR10389497 96 Well

Guinea Pig Pancreastatin ELISA kit

Sign In for Pricing
View Details
Guinea Pig Anti Chitobioside Antibody ELISA Kit
MBS7279699-01 48 Well

Guinea Pig Anti Chitobioside Antibody ELISA Kit

Sign In for Pricing
View Details
Guinea Pig Anti Chitobioside Antibody ELISA Kit
MBS7279699-02 96 Well

Guinea Pig Anti Chitobioside Antibody ELISA Kit

Sign In for Pricing
View Details
Guinea Pig Anti Chitobioside Antibody ELISA Kit
MBS7279699-03 5x 96 Well

Guinea Pig Anti Chitobioside Antibody ELISA Kit

Sign In for Pricing
View Details