Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MED25 Peptide - N-terminal region

MED25 Peptide - N-terminal region

Product Specifications

Product Name Alternative

ACID1, ARC92, CMT2B2, DKFZp434K0512, MGC70671, P78, PTOV2, TCBAP0758

UniProt

Q71SY5

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MED25 Rabbit Polyclonal Antibody (orb581181) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

ChIP, WB

NCBI Accession Number

NP_112235

Preservative

Lyophilized powder

AA Sequence

EGLRKHYLLPAIEYFNGGPPAETDFGGDYGGTQYSLVVFNTVDCAPESYV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

2,3-Dichlorophenoxyacetic Acid
TRC-D474153-5G 5 g

2,3-Dichlorophenoxyacetic Acid

Sign In for Pricing
View Details
CXCL7 (PPBP) (N-term) Rabbit Polyclonal Antibody
AP17656PU-N 400 µL

CXCL7 (PPBP) (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Trifloxystrobin Acid
TRC-T138185-10MG 10 mg

Trifloxystrobin Acid

Sign In for Pricing
View Details
p60 CAF1 (CHAF1B) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI4F7]
TA506840AM 100 µL

p60 CAF1 (CHAF1B) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI4F7]

Sign In for Pricing
View Details
Tissue FFPE Sections, Prostate
CS804078 5x 5 µm

Tissue FFPE Sections, Prostate

Sign In for Pricing
View Details
HAO2 (NM_001005783) Human Over-expression Lysate
LY423655 100 µg

HAO2 (NM_001005783) Human Over-expression Lysate

Sign In for Pricing
View Details