Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MED25 Peptide - N-terminal region

MED25 Peptide - N-terminal region

Product Specifications

Product Name Alternative

ACID1, ARC92, CMT2B2, DKFZp434K0512, MGC70671, P78, PTOV2, TCBAP0758

UniProt

Q71SY5

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MED25 Rabbit Polyclonal Antibody (orb581181) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

ChIP, WB

NCBI Accession Number

NP_112235

Preservative

Lyophilized powder

AA Sequence

EGLRKHYLLPAIEYFNGGPPAETDFGGDYGGTQYSLVVFNTVDCAPESYV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HSP-27 Polyclonal Antibody
AN005840L-01 25 µL

HSP-27 Polyclonal Antibody

Sign In for Pricing
View Details
HSP-27 Polyclonal Antibody
AN005840L-02 100 µL

HSP-27 Polyclonal Antibody

Sign In for Pricing
View Details
Docusate Sodium
TRC-D494660-1G 1 g

Docusate Sodium

Sign In for Pricing
View Details
ATRX Rabbit Polyclonal Antibody
TA372087 100 µL

ATRX Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant Human CSNK2A1/CK2A1 Protein (GST Tag)
PKSH030405 50 µg

Recombinant Human CSNK2A1/CK2A1 Protein (GST Tag)

Sign In for Pricing
View Details
Anti-INPP4A
Y058766 100 µg

Anti-INPP4A

Sign In for Pricing
View Details