Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MEF2D Peptide - middle region

MEF2D Peptide - middle region

Product Specifications

Product Name Alternative

DKFZp686I1536

UniProt

Q14814

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MEF2D Rabbit Polyclonal Antibody (orb576799) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_005911

Preservative

Lyophilized powder

AA Sequence

GDGLSSPAGGSYETGDRDDGRGDFGPTLGLLRPAPEPEAEGSAVKRMRLD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tomivosertib (eFT-508)
S8275-5mg 5 mg

Tomivosertib (eFT-508)

Sign In for Pricing
View Details
Mmu-miR-6540-5p miRNA Agomir
CMN1250-01 5 nmol

Mmu-miR-6540-5p miRNA Agomir

Sign In for Pricing
View Details
Mmu-miR-6540-5p miRNA Agomir
CMN1250-02 10 nmol

Mmu-miR-6540-5p miRNA Agomir

Sign In for Pricing
View Details
Mmu-miR-6540-5p miRNA Agomir
CMN1250-03 20 nmol

Mmu-miR-6540-5p miRNA Agomir

Sign In for Pricing
View Details
Thyrotropin-Releasing Hormone (TRH) Free Acid
M20830-01 1 g

Thyrotropin-Releasing Hormone (TRH) Free Acid

Sign In for Pricing
View Details
Thyrotropin-Releasing Hormone (TRH) Free Acid
M20830-02 200 mg

Thyrotropin-Releasing Hormone (TRH) Free Acid

Sign In for Pricing
View Details