Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MEF2D Peptide - middle region

MEF2D Peptide - middle region

Product Specifications

Product Name Alternative

DKFZp686I1536

UniProt

Q14814

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MEF2D Rabbit Polyclonal Antibody (orb576799) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_005911

Preservative

Lyophilized powder

AA Sequence

GDGLSSPAGGSYETGDRDDGRGDFGPTLGLLRPAPEPEAEGSAVKRMRLD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

OVOL1 Polyclonal Antibody, FITC Conjugated
A63088-050 50 µL

OVOL1 Polyclonal Antibody, FITC Conjugated

Sign In for Pricing
View Details
NR5A2 Polyclonal Antibody
ABP59529-01 30 µL

NR5A2 Polyclonal Antibody

Sign In for Pricing
View Details
NR5A2 Polyclonal Antibody
ABP59529-02 100 µL

NR5A2 Polyclonal Antibody

Sign In for Pricing
View Details
NR5A2 Polyclonal Antibody
ABP59529-03 200 µL

NR5A2 Polyclonal Antibody

Sign In for Pricing
View Details
DACH2 Antibody - C-terminal region (ARP32426_P050)
ARP32426_P050 100 µL

DACH2 Antibody - C-terminal region (ARP32426_P050)

Sign In for Pricing
View Details
ACTB ELISA Kit (Mouse)
ASB-OKEH05030 96 Well

ACTB ELISA Kit (Mouse)

Sign In for Pricing
View Details