Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Meis1 Peptide - N-terminal region

Meis1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

C530044H18Rik, Evi8

UniProt

Q60954

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Meis1 Rabbit Polyclonal Antibody (orb329965) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_034919

Preservative

Lyophilized powder

AA Sequence

YGDPHAARSMQPVHHLNHGPPLHSHQYPHTAHTNAMAPSMGSSVNDALKR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IGFBP3 Human Gene Knockout Kit (CRISPR)
KN209150BN 1 Kit

IGFBP3 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
2-Ethenyl-3,4-dihydroquinazolin-4-one
TRC-B126350-50MG 50 mg

2-Ethenyl-3,4-dihydroquinazolin-4-one

Sign In for Pricing
View Details
SH3BGRL Rabbit Polyclonal Antibody
TA370280 100 µL

SH3BGRL Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
SHP2 (PTPN11) (NM_002834) Human Recombinant Protein
TP750164 50 µg

SHP2 (PTPN11) (NM_002834) Human Recombinant Protein

Sign In for Pricing
View Details
Bcr Mouse Gene Knockout Kit (CRISPR)
KN502122 1 Kit

Bcr Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
APC/XFD750 Anti-human CD3 Antibody *SK7*
100331E0-AAT 25 Tests

APC/XFD750 Anti-human CD3 Antibody *SK7*

Sign In for Pricing
View Details