Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Meis1 Peptide - N-terminal region

Meis1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

C530044H18Rik, Evi8

UniProt

Q60954

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Meis1 Rabbit Polyclonal Antibody (orb329965) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_034919

Preservative

Lyophilized powder

AA Sequence

YGDPHAARSMQPVHHLNHGPPLHSHQYPHTAHTNAMAPSMGSSVNDALKR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Amplite® Colorimetric Total NADP and NADPH Assay Kit *Enhanced Sensitivity*
15276-AAT 400 Tests

Amplite® Colorimetric Total NADP and NADPH Assay Kit *Enhanced Sensitivity*

Sign In for Pricing
View Details
FITC Anti-Mouse CD161/NK1.1 Antibody[PK136]
E-AB-F0987UC-01 25 µg

FITC Anti-Mouse CD161/NK1.1 Antibody[PK136]

Sign In for Pricing
View Details
FITC Anti-Mouse CD161/NK1.1 Antibody[PK136]
E-AB-F0987UC-02 100 µg

FITC Anti-Mouse CD161/NK1.1 Antibody[PK136]

Sign In for Pricing
View Details
Tmem104 Mouse Gene Knockout Kit (CRISPR)
KN517692 1 Kit

Tmem104 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Tissue FFPE Sections, Kidney
CS801536 5x 5 µm

Tissue FFPE Sections, Kidney

Sign In for Pricing
View Details
2-Bromothiophene
TRC-B688185-1G 1 g

2-Bromothiophene

Sign In for Pricing
View Details