Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Meis3 Peptide - C-terminal region

Meis3 Peptide - C-terminal region

Product Specifications

Product Name Alternative

Mrg2

UniProt

D4A9U2

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Meis3 Rabbit Polyclonal Antibody (orb580152) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001101942

Preservative

Lyophilized powder

AA Sequence

LAQDTGLTILQVNNWFINARRRIVQPMIDQSNRTGQGASFNPEGQSMAGY

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Bnip3l shRNA (UAS) - Lentiviral mouse Bnip3l shRNA (UAS, RFP) (25)
GTR15122207 1 Vial

Lentiviral mouse Bnip3l shRNA (UAS) - Lentiviral mouse Bnip3l shRNA (UAS, RFP) (25)

Sign In for Pricing
View Details
NR3C2 Polyclonal Antibody
MBS9433574-01 0.05 mL

NR3C2 Polyclonal Antibody

Sign In for Pricing
View Details
NR3C2 Polyclonal Antibody
MBS9433574-02 0.1 mL

NR3C2 Polyclonal Antibody

Sign In for Pricing
View Details
NR3C2 Polyclonal Antibody
MBS9433574-03 5x 0.1 mL

NR3C2 Polyclonal Antibody

Sign In for Pricing
View Details
p27 KIP 1 (CDKN1B) (NM_004064) Human Over-expression Lysate
LC401318 20 µg

p27 KIP 1 (CDKN1B) (NM_004064) Human Over-expression Lysate

Sign In for Pricing
View Details
GP1BA Antibody
MBS7125720-01 0.05 mL

GP1BA Antibody

Sign In for Pricing
View Details