Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Meis3 Peptide - C-terminal region

Meis3 Peptide - C-terminal region

Product Specifications

Product Name Alternative

Mrg2

UniProt

D4A9U2

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Meis3 Rabbit Polyclonal Antibody (orb580152) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001101942

Preservative

Lyophilized powder

AA Sequence

LAQDTGLTILQVNNWFINARRRIVQPMIDQSNRTGQGASFNPEGQSMAGY

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Tissue Polypeptide Antigen (TPA) ELISA Kit
QY-E21477 96 Tests

Mouse Tissue Polypeptide Antigen (TPA) ELISA Kit

Sign In for Pricing
View Details
PDHK2 [Pyruvate Dehydrogenase [Lipoamide]] Kinase Isozyme 2, Mitochondrial, Pyruvate Dehydrogenase Kinase Isoform 2, PDH Kinase 2, PDKII, PDK2) (Biotin)
131079-Biotin 100 µL

PDHK2 [Pyruvate Dehydrogenase [Lipoamide]] Kinase Isozyme 2, Mitochondrial, Pyruvate Dehydrogenase Kinase Isoform 2, PDH Kinase 2, PDKII, PDK2) (Biotin)

Sign In for Pricing
View Details
LETMD1 (LETM1 Domain-containing Protein 1, HCCR1, HCCR-1, HCCR-2, HCRR-2, 1110019O13Rik) discontinued
211748-01 20 µL

LETMD1 (LETM1 Domain-containing Protein 1, HCCR1, HCCR-1, HCCR-2, HCRR-2, 1110019O13Rik) discontinued

Sign In for Pricing
View Details
LETMD1 (LETM1 Domain-containing Protein 1, HCCR1, HCCR-1, HCCR-2, HCRR-2, 1110019O13Rik) discontinued
211748-02 100 µL

LETMD1 (LETM1 Domain-containing Protein 1, HCCR1, HCCR-1, HCCR-2, HCRR-2, 1110019O13Rik) discontinued

Sign In for Pricing
View Details
4- (4-Chlorophenylsulfanyl) Piperidine Hydrochloride ≥95% (NMR)
232545-01 100 mg

4- (4-Chlorophenylsulfanyl) Piperidine Hydrochloride ≥95% (NMR)

Sign In for Pricing
View Details
4- (4-Chlorophenylsulfanyl) Piperidine Hydrochloride ≥95% (NMR)
232545-02 250 mg

4- (4-Chlorophenylsulfanyl) Piperidine Hydrochloride ≥95% (NMR)

Sign In for Pricing
View Details