Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Memo1 Peptide - middle region

Memo1 Peptide - middle region

Product Specifications

Product Name Alternative

0610016J10Rik, D930048L02Rik

UniProt

Q91VH6

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Memo1 Rabbit Polyclonal Antibody (orb579616) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_598532

Preservative

Lyophilized powder

AA Sequence

CHWGQRFRYSYYDESQGEIYRSIEHLDKMGMSIIEQLDPVSFSNYLKKYH

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Aeromonas Hydrophila cysG3 Protein
VAng-Lsx0970-50gEcoli 50 µg (E. coli)

Recombinant Aeromonas Hydrophila cysG3 Protein

Sign In for Pricing
View Details
AChRα1 Polyclonal Antibody
orb311462-01 50 μL

AChRα1 Polyclonal Antibody

Sign In for Pricing
View Details
AChRα1 Polyclonal Antibody
orb311462-02 100 µL

AChRα1 Polyclonal Antibody

Sign In for Pricing
View Details
Nphs1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
32060114 3x 1.0 µg

Nphs1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)

Sign In for Pricing
View Details
Gossypetin 3-sophoroside-8-glucoside
BUP22083 1 mg

Gossypetin 3-sophoroside-8-glucoside

Sign In for Pricing
View Details
VC O1 mAb4
MBS478118-01 1 mg

VC O1 mAb4

Sign In for Pricing
View Details