Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Memo1 Peptide - middle region

Memo1 Peptide - middle region

Product Specifications

Product Name Alternative

0610016J10Rik, D930048L02Rik

UniProt

Q91VH6

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Memo1 Rabbit Polyclonal Antibody (orb579616) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_598532

Preservative

Lyophilized powder

AA Sequence

CHWGQRFRYSYYDESQGEIYRSIEHLDKMGMSIIEQLDPVSFSNYLKKYH

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

anti-human CD104-Purified (with Antibiotics)
MBS666431-01 0.1 mg

anti-human CD104-Purified (with Antibiotics)

Sign In for Pricing
View Details
anti-human CD104-Purified (with Antibiotics)
MBS666431-02 5x 0.1 mg

anti-human CD104-Purified (with Antibiotics)

Sign In for Pricing
View Details
Met Rabbit Polyclonal Antibody
ABP57458-01 30 µL

Met Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Met Rabbit Polyclonal Antibody
ABP57458-02 100 µL

Met Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Met Rabbit Polyclonal Antibody
ABP57458-03 200 µL

Met Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
POU4F1 (FITC)
572981-01 50 µL

POU4F1 (FITC)

Sign In for Pricing
View Details