Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Memo1 Peptide - C-terminal region

Memo1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

MGC116222, RGD1309929

UniProt

Q4QQR9

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Memo1 Rabbit Polyclonal Antibody (orb583312) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001025088

Preservative

Lyophilized powder

AA Sequence

KLFSKYLADPSNLFVVSSDFCHWGQRFRYSYYDESQGEIYRSIEHLDKMG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ARHGAP9 Protein Lysate
OCOA15531-20UG 20 µg

ARHGAP9 Protein Lysate

Sign In for Pricing
View Details
Rabbit Polyclonal p62/SQSTM1 Antibody [Alexa Fluor 532]
NBP1-42822AF532 0.1 mL

Rabbit Polyclonal p62/SQSTM1 Antibody [Alexa Fluor 532]

Sign In for Pricing
View Details
Recombinant Human Flotillin 2 Protein - (Dry Ice)
H00002319-P01-25ug 25 µg

Recombinant Human Flotillin 2 Protein - (Dry Ice)

Sign In for Pricing
View Details
MSRB2 Polyclonal Antibody, PE Conjugated
bs-17861R-PE 100 µL

MSRB2 Polyclonal Antibody, PE Conjugated

Sign In for Pricing
View Details
Nori® Equine NGF-B ELISA Kit
GR106819 96 Well

Nori® Equine NGF-B ELISA Kit

Sign In for Pricing
View Details
Artificial Sebaceous Gland Secretion (BZ424) - 1000mL
BZ424-01 100 mL

Artificial Sebaceous Gland Secretion (BZ424) - 1000mL

Sign In for Pricing
View Details