Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Memo1 Peptide - C-terminal region

Memo1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

MGC116222, RGD1309929

UniProt

Q4QQR9

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Memo1 Rabbit Polyclonal Antibody (orb583312) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001025088

Preservative

Lyophilized powder

AA Sequence

KLFSKYLADPSNLFVVSSDFCHWGQRFRYSYYDESQGEIYRSIEHLDKMG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Polypterus sp. Cytochrome c oxidase subunit 1 (mt-co1)
orb2919324-01 20 µg

Recombinant Polypterus sp. Cytochrome c oxidase subunit 1 (mt-co1)

Sign In for Pricing
View Details
Recombinant Polypterus sp. Cytochrome c oxidase subunit 1 (mt-co1)
orb2919324-02 100 µg

Recombinant Polypterus sp. Cytochrome c oxidase subunit 1 (mt-co1)

Sign In for Pricing
View Details
EPS15L2 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
57079111 3x 1.0 µg

EPS15L2 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
Alexa Fluor® 647 anti-Histone H3 Phospho (Ser10)
GT19127 100 Tests

Alexa Fluor® 647 anti-Histone H3 Phospho (Ser10)

Sign In for Pricing
View Details
Recombinant Mouse CD200R1 Protein (His & Fc tag)
ARP7968-01 10 µg

Recombinant Mouse CD200R1 Protein (His & Fc tag)

Sign In for Pricing
View Details
Recombinant Mouse CD200R1 Protein (His & Fc tag)
ARP7968-02 50 µg

Recombinant Mouse CD200R1 Protein (His & Fc tag)

Sign In for Pricing
View Details