Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Memo1 Peptide - C-terminal region

Memo1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

MGC116222, RGD1309929

UniProt

Q4QQR9

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Memo1 Rabbit Polyclonal Antibody (orb583312) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001025088

Preservative

Lyophilized powder

AA Sequence

KLFSKYLADPSNLFVVSSDFCHWGQRFRYSYYDESQGEIYRSIEHLDKMG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NGAL (LCN2) Mouse Monoclonal Antibody [Clone:3F1]
E45M21499 100 µg

NGAL (LCN2) Mouse Monoclonal Antibody [Clone:3F1]

Sign In for Pricing
View Details
ZNF566 Peptide - middle region (AAP36086)
AAP36086-100UG 100 µg

ZNF566 Peptide - middle region (AAP36086)

Sign In for Pricing
View Details
Gpr108 Mouse qPCR Primer Pair (NM_030084)
MP205078 200 Reactions

Gpr108 Mouse qPCR Primer Pair (NM_030084)

Sign In for Pricing
View Details
XFD680 Anti-human CD29 Antibody *HI29a*
10290190-AAT 100 Tests

XFD680 Anti-human CD29 Antibody *HI29a*

Sign In for Pricing
View Details
Mouse Fabp7 ELISA Kit
orb565590-01 48 Tests

Mouse Fabp7 ELISA Kit

Sign In for Pricing
View Details
Mouse Fabp7 ELISA Kit
orb565590-02 96 Tests

Mouse Fabp7 ELISA Kit

Sign In for Pricing
View Details