Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Men1 Peptide - middle region

Men1 Peptide - middle region

Product Specifications

Product Name Alternative

AW045611

UniProt

O88559

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Men1 Rabbit Polyclonal Antibody (orb576149) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_032609

Preservative

Lyophilized powder

AA Sequence

YNYCREDEEIYKEFFEVANDVIPNLLKEAASLLETGEERTGEQAQGTQGQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Texas Red® goat anti-rabbit IgG (H+L)
16869-AAT 1 mg

Texas Red® goat anti-rabbit IgG (H+L)

Sign In for Pricing
View Details
SEPHS1 Polyclonal Antibody
E-AB-53184-01 20 µL

SEPHS1 Polyclonal Antibody

Sign In for Pricing
View Details
SEPHS1 Polyclonal Antibody
E-AB-53184-02 60 µL

SEPHS1 Polyclonal Antibody

Sign In for Pricing
View Details
SEPHS1 Polyclonal Antibody
E-AB-53184-03 120 µL

SEPHS1 Polyclonal Antibody

Sign In for Pricing
View Details
SEPHS1 Polyclonal Antibody
E-AB-53184-04 200 µL

SEPHS1 Polyclonal Antibody

Sign In for Pricing
View Details
CD50 (ICAM-3) (101-1D2), CF740 conjugate, 0.1mg/mL
BNC740177-500 1x 500 µL

CD50 (ICAM-3) (101-1D2), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details