Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Men1 Peptide - middle region

Men1 Peptide - middle region

Product Specifications

Product Name Alternative

AW045611

UniProt

O88559

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Men1 Rabbit Polyclonal Antibody (orb576149) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_032609

Preservative

Lyophilized powder

AA Sequence

YNYCREDEEIYKEFFEVANDVIPNLLKEAASLLETGEERTGEQAQGTQGQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Zfp318 Mouse Gene Knockout Kit (CRISPR)
KN519784 1 Kit

Zfp318 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
1,4-Bis[(2-aminoethyl)amino]-9,10-anthracenedione
TRC-B403480-100MG 100 mg

1,4-Bis[(2-aminoethyl)amino]-9,10-anthracenedione

Sign In for Pricing
View Details
Epstein-Barr Virus (LMP-1) (CS2), 1mg/mL
BNUM1742-50 1x 50 µL

Epstein-Barr Virus (LMP-1) (CS2), 1mg/mL

Sign In for Pricing
View Details
Mouse CHI3L1 (Chitinase 3-like 1) ELISA Kit
E-EL-M0016-01 24 Tests

Mouse CHI3L1 (Chitinase 3-like 1) ELISA Kit

Sign In for Pricing
View Details
Mouse CHI3L1 (Chitinase 3-like 1) ELISA Kit
E-EL-M0016-02 48 Tests

Mouse CHI3L1 (Chitinase 3-like 1) ELISA Kit

Sign In for Pricing
View Details
Mouse CHI3L1 (Chitinase 3-like 1) ELISA Kit
E-EL-M0016-03 96 Tests

Mouse CHI3L1 (Chitinase 3-like 1) ELISA Kit

Sign In for Pricing
View Details