MESP1 Peptide - C-terminal region
MESP1 Peptide - C-terminal region
Product Specifications
Product Name Alternative
MGC10676, bHLHc5
UniProt
Q9BRJ9
Field of Research
Stem Cell & Developmental Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with MESP1 Rabbit Polyclonal Antibody (orb575723) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_061140
Preservative
Lyophilized powder
AA Sequence
GRGLGLVSAVRAGASWGSPPACPGARAAPEPRDPPALFAEAACPEGQAME
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
TRC-J211205-10MG 10 mg
Juvenile Hormone B 3 (Mixture of Diastereomers), Technical Grade
Sign In for Pricing
View Details 
BNC680736-500 1x 500 µL
Neurofilament (NF-L) (NFL/736), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC942040-500 1x 500 µL
ACTH (Adrenocorticotrophic Hormone) (Pituitary Marker) (CLIP/2040R), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
E-CL-M0077-01 24 Tests
Mouse GLP-1 (Glucagon Like Peptide 1) CLIA Kit
Sign In for Pricing
View Details E-CL-M0077-02 48 Tests
Mouse GLP-1 (Glucagon Like Peptide 1) CLIA Kit
Sign In for Pricing
View Details