Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MESP1 Peptide - C-terminal region

MESP1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

MGC10676, bHLHc5

UniProt

Q9BRJ9

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MESP1 Rabbit Polyclonal Antibody (orb575723) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_061140

Preservative

Lyophilized powder

AA Sequence

GRGLGLVSAVRAGASWGSPPACPGARAAPEPRDPPALFAEAACPEGQAME

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cyba Mouse Gene Knockout Kit (CRISPR)
KN304074RB 1 Kit

Cyba Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
LRRC41 Antibody
8C16455-AAT 50 µg

LRRC41 Antibody

Sign In for Pricing
View Details
c-Jun (JUN) Rabbit Polyclonal Antibody
TA377673 100 µL

c-Jun (JUN) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
SMAD2 Rabbit Polyclonal Antibody
AP21096PU-N 100 µg

SMAD2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
2-(N-Fmoc-4-aminobutyl)-1,3-propanediol
TRC-F620000-500MG 500 mg

2-(N-Fmoc-4-aminobutyl)-1,3-propanediol

Sign In for Pricing
View Details
HypoGel® 200 OH
SP20011015000.100G 100 g

HypoGel® 200 OH

Sign In for Pricing
View Details