Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mettl4 Peptide - C-terminal region

Mettl4 Peptide - C-terminal region

Product Specifications

Product Name Alternative

RGD1306451, Mettl4, HsT661, AV296509, 2410198H06Rik, A730091E08Rik

UniProt

D3ZD59

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Mettl4 Rabbit Polyclonal Antibody (orb580565) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001178743

Preservative

Lyophilized powder

AA Sequence

SGEFVFPLDSLHKKPYECLVLGRVKEKTALALRNEAVRTPPVPDQRLIVS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NBD-556
A3649-25 25 mg

NBD-556

Sign In for Pricing
View Details
RGF1B Rabbit Polyclonal Antibody
MBS9516591-01 0.05 mL

RGF1B Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
RGF1B Rabbit Polyclonal Antibody
MBS9516591-02 0.1 mL

RGF1B Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
RGF1B Rabbit Polyclonal Antibody
MBS9516591-03 5x 0.1 mL

RGF1B Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
POLR1C Peptide
DF6072-BP 1 mg

POLR1C Peptide

Sign In for Pricing
View Details
STYXL2 Antibody
orb3169323 100 µg

STYXL2 Antibody

Sign In for Pricing
View Details