Mfap1a Peptide - N-terminal region
Mfap1a Peptide - N-terminal region
Product Specifications
Product Name Alternative
4432409M24Rik, Mfap1
UniProt
Q9CQU1
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with Mfap1a Rabbit Polyclonal Antibody (orb326113) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_080496
Preservative
Lyophilized powder
AA Sequence
QFIKKAKEQEAEPEEQEEDSSSDPRLRRLQNRISEDVEERLARHRKIVEP
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
E13427h 96 Tests
ELISA Kit For N-acetylated-alpha-linked acidic dipeptidase 2
Sign In for Pricing
View Details ![N-[2-Amino-4-chloro-6-[[ (1R,4R) -4- (hydroxymethyl) -2-cyclopenten-1-yl]amino]-5-pyrimidinyl]formamide](https://cdn.genprice.uk/genprice/uk/genprice2.webp)
457707-01 5 mg
N-[2-Amino-4-chloro-6-[[ (1R,4R) -4- (hydroxymethyl) -2-cyclopenten-1-yl]amino]-5-pyrimidinyl]formamide
Sign In for Pricing
View Details 457707-02 10 mg
N-[2-Amino-4-chloro-6-[[ (1R,4R) -4- (hydroxymethyl) -2-cyclopenten-1-yl]amino]-5-pyrimidinyl]formamide
Sign In for Pricing
View Details 
TRV-0001379-01 10 µg
Active Macrophage Inflammatory Protein 1 Beta (MIP1b)
Sign In for Pricing
View Details