Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MELTF Peptide - C-terminal region

MELTF Peptide - C-terminal region

Product Specifications

Product Name Alternative

MTf, MFI2, MTF1, CD228, MAP97

UniProt

P08582

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MELTF Rabbit Polyclonal Antibody (orb584644) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

IF, WB

NCBI Accession Number

NP_005920

Preservative

Lyophilized powder

AA Sequence

CVPVNNPKNYPSSLCALCVGDEQGRNKCVGNSQERYYGYRGAFRCLVENA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IFNA2 siRNA Oligos set (Human)
24253171 3x 5 nmol

IFNA2 siRNA Oligos set (Human)

Sign In for Pricing
View Details
1-Bromo-2-methoxyethane ≥92% (GC)
228725-01 25 g

1-Bromo-2-methoxyethane ≥92% (GC)

Sign In for Pricing
View Details
1-Bromo-2-methoxyethane ≥92% (GC)
228725-02 100 g

1-Bromo-2-methoxyethane ≥92% (GC)

Sign In for Pricing
View Details
1-Bromo-2-methoxyethane ≥92% (GC)
228725-03 250 g

1-Bromo-2-methoxyethane ≥92% (GC)

Sign In for Pricing
View Details
1-Bromo-2-methoxyethane ≥92% (GC)
228725-04 1 Kg

1-Bromo-2-methoxyethane ≥92% (GC)

Sign In for Pricing
View Details
Recombinant Murine Beta-defensin 1
AP60213 Inquire

Recombinant Murine Beta-defensin 1

Sign In for Pricing
View Details