Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MELTF Peptide - C-terminal region

MELTF Peptide - C-terminal region

Product Specifications

Product Name Alternative

MTf, MFI2, MTF1, CD228, MAP97

UniProt

P08582

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MELTF Rabbit Polyclonal Antibody (orb584644) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

IF, WB

NCBI Accession Number

NP_005920

Preservative

Lyophilized powder

AA Sequence

CVPVNNPKNYPSSLCALCVGDEQGRNKCVGNSQERYYGYRGAFRCLVENA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PAPPA2 Blocking Peptide
33R-7246 0.1 mg

PAPPA2 Blocking Peptide

Sign In for Pricing
View Details
CX062 rabbit pAb
MBS8600945-01 0.1 mL

CX062 rabbit pAb

Sign In for Pricing
View Details
CX062 rabbit pAb
MBS8600945-02 0.1 mL (AF405L)

CX062 rabbit pAb

Sign In for Pricing
View Details
CX062 rabbit pAb
MBS8600945-03 0.1 mL (AF405S)

CX062 rabbit pAb

Sign In for Pricing
View Details
CX062 rabbit pAb
MBS8600945-04 0.1 mL (AF610)

CX062 rabbit pAb

Sign In for Pricing
View Details
CX062 rabbit pAb
MBS8600945-05 0.1 mL (AF635)

CX062 rabbit pAb

Sign In for Pricing
View Details