Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MFN1 Peptide - middle region

MFN1 Peptide - middle region

Product Specifications

Product Name Alternative

DKFZp762F247, FLJ20693, MGC41806, hfzo1, hfzo2

UniProt

Q8R4Z9

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MFN1 Rabbit Polyclonal Antibody (orb583674) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_284941

Preservative

Lyophilized powder

AA Sequence

QVDITQKQLEEEIARLPKEIDQLEKIQNNSKLLRNKAVQLENELENFTKQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Nrxn2 activation kit by CRISPRa
GA202972 1 Kit

Mouse Nrxn2 activation kit by CRISPRa

Sign In for Pricing
View Details
Recombinant Human 1-acyl-sn-glycerol-3-phosphate acyltransferase beta (AGPAT2), partial
MBS7053659 0.05 mg (Yeast)

Recombinant Human 1-acyl-sn-glycerol-3-phosphate acyltransferase beta (AGPAT2), partial

Sign In for Pricing
View Details
MEK-1 Polyclonal Antibody
JOT-AP11249-01 20 µL

MEK-1 Polyclonal Antibody

Sign In for Pricing
View Details
MEK-1 Polyclonal Antibody
JOT-AP11249-02 50 μL

MEK-1 Polyclonal Antibody

Sign In for Pricing
View Details
MEK-1 Polyclonal Antibody
JOT-AP11249-03 100 µL

MEK-1 Polyclonal Antibody

Sign In for Pricing
View Details
PKMYT1 CRISPR All-in-one AAV vector set (with saCas9)(Mouse)
36884154 3x 1.0 µg DNA

PKMYT1 CRISPR All-in-one AAV vector set (with saCas9)(Mouse)

Sign In for Pricing
View Details