Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MFN1 Peptide - middle region

MFN1 Peptide - middle region

Product Specifications

Product Name Alternative

DKFZp762F247, FLJ20693, MGC41806, hfzo1, hfzo2

UniProt

Q8R4Z9

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MFN1 Rabbit Polyclonal Antibody (orb583674) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_284941

Preservative

Lyophilized powder

AA Sequence

QVDITQKQLEEEIARLPKEIDQLEKIQNNSKLLRNKAVQLENELENFTKQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Olr1346 Protein Vector (Rat) (pPB-N-His)
PV287851 500 ng

Olr1346 Protein Vector (Rat) (pPB-N-His)

Sign In for Pricing
View Details
1- (3-aminophenyl) pyrrolidin-2-one
sc-272922 1 g

1- (3-aminophenyl) pyrrolidin-2-one

Sign In for Pricing
View Details
Donkey Mercaptopyruvate Sulfurtransferase ELISA Kit
MBS065219 Inquire

Donkey Mercaptopyruvate Sulfurtransferase ELISA Kit

Sign In for Pricing
View Details
ITIH1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
K1106005 3x 1.0 µg

ITIH1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
Cyclosporin B 1mg
A15433-1 1 mg

Cyclosporin B 1mg

Sign In for Pricing
View Details
A3galt2 (NM_001009819) Mouse Tagged ORF Clone Lentiviral Particle
MR223563L3V 200 µL

A3galt2 (NM_001009819) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details