Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mfng Peptide - middle region

Mfng Peptide - middle region

Product Specifications

Product Name Alternative

AW546563

UniProt

O09008

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Mfng Rabbit Polyclonal Antibody (orb579452) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_032621

Preservative

Lyophilized powder

AA Sequence

CKLGGRLQPSPLFHSHLETLQLLGAAQLPEQVTLSYGVFEGKLNVIKLPG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Hyal5 ORF Vector (Rat) (pORF)
ORF068460 1.0 µg DNA

Hyal5 ORF Vector (Rat) (pORF)

Sign In for Pricing
View Details
CD117 antibody (Spectral Red)
MBS5317919-01 0.1 mg

CD117 antibody (Spectral Red)

Sign In for Pricing
View Details
CD117 antibody (Spectral Red)
MBS5317919-02 5x 0.1 mg

CD117 antibody (Spectral Red)

Sign In for Pricing
View Details
Bcl-2 (Apoptosis regulator Bcl-2, B Cell CLL/lymphoma-2) (BSA & Azide Free)
168646-AF 100 µg

Bcl-2 (Apoptosis regulator Bcl-2, B Cell CLL/lymphoma-2) (BSA & Azide Free)

Sign In for Pricing
View Details
HSPA4 Rabbit Polyclonal Antibody (Biotin)
orb2117296 100 µL

HSPA4 Rabbit Polyclonal Antibody (Biotin)

Sign In for Pricing
View Details
GnRH-R antagonist-2
orb3173353-01 25 mg

GnRH-R antagonist-2

Sign In for Pricing
View Details