Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mfng Peptide - middle region

Mfng Peptide - middle region

Product Specifications

Product Name Alternative

AW546563

UniProt

O09008

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Mfng Rabbit Polyclonal Antibody (orb579452) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_032621

Preservative

Lyophilized powder

AA Sequence

CKLGGRLQPSPLFHSHLETLQLLGAAQLPEQVTLSYGVFEGKLNVIKLPG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LAT2 (SLC7A8) (NM_001267036) Human Untagged Clone
SC332831 10 µg

LAT2 (SLC7A8) (NM_001267036) Human Untagged Clone

Sign In for Pricing
View Details
Nmi 3'UTR GFP Stable Cell Line
TU264045 1.0 mL

Nmi 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
MAGEA4 Human Over-expression Lysate
orb1362909 20 µg

MAGEA4 Human Over-expression Lysate

Sign In for Pricing
View Details
Nucleobindin 2 CRISPR Activation Plasmid (m)
sc-424686-ACT 20 µg

Nucleobindin 2 CRISPR Activation Plasmid (m)

Sign In for Pricing
View Details
Nequinate
C01289-5mg 5 mg

Nequinate

Sign In for Pricing
View Details
1.0M HEPES pH 7.5
38278-04 100 mL

1.0M HEPES pH 7.5

Sign In for Pricing
View Details