FLVCR1 Peptide - middle region
FLVCR1 Peptide - middle region
Product Specifications
Product Name Alternative
FLVCR, Mfsd7b, 9630055N22Rik
UniProt
B2RXV4
Field of Research
Neuroscience
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with FLVCR1 Rabbit Polyclonal Antibody (orb325948) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_001074728
Preservative
Lyophilized powder
AA Sequence
GPKEVSTACATAVLGNQLGTAVGFLLPPVLVPALGTQNSTGLLAHTQNNT
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS716515-01 0.1 mL
Rabbit anti-human Nipped-B homolog (Drosophila) polyclonal Antibody
Sign In for Pricing
View Details MBS716515-02 5x 0.1 mL
Rabbit anti-human Nipped-B homolog (Drosophila) polyclonal Antibody
Sign In for Pricing
View Details 
VAng-Lsx2357-500gEcoli 500 µg (E. coli)
Recombinant Borrelia Recurrentis rplB Protein (aa 1-277)
Sign In for Pricing
View Details 
TA369833 100 µL
Biliverdin Reductase (BLVRA) Rabbit Polyclonal Antibody
Sign In for Pricing
View Details