FLVCR1 Peptide - middle region
FLVCR1 Peptide - middle region
Product Specifications
Product Name Alternative
FLVCR, Mfsd7b, 9630055N22Rik
UniProt
B2RXV4
Field of Research
Neuroscience
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with FLVCR1 Rabbit Polyclonal Antibody (orb325948) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_001074728
Preservative
Lyophilized powder
AA Sequence
GPKEVSTACATAVLGNQLGTAVGFLLPPVLVPALGTQNSTGLLAHTQNNT
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
K6808408 1.0 µg DNA
Esr1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 3)
Sign In for Pricing
View Details MBS6347148-01 0.1 mL
SH2D2A, ID (SH2D2A, SCAP, TSAD, VRAP, SH2 domain-containing protein 2A, SH2 domain-containing adapter protein, T cell-specific adapter protein, VEGF receptor-associated protein) (MaxLight 490)
Sign In for Pricing
View Details MBS6347148-02 5x 0.1 mL
SH2D2A, ID (SH2D2A, SCAP, TSAD, VRAP, SH2 domain-containing protein 2A, SH2 domain-containing adapter protein, T cell-specific adapter protein, VEGF receptor-associated protein) (MaxLight 490)
Sign In for Pricing
View Details