Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MGC87631 Peptide - middle region

MGC87631 Peptide - middle region

Product Specifications

UniProt

Q6NUI1

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MGC87631 Rabbit Polyclonal Antibody (orb325908) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001004306

Preservative

Lyophilized powder

AA Sequence

VDKRDRKKSIQQLVPEYKEKQTPESLPQNNNPAAPSQAEGGEGGVACGTV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SYNPR, CT (SYNPR, Synaptoporin) (APC) discontinued
042522-APC 200 µL

SYNPR, CT (SYNPR, Synaptoporin) (APC) discontinued

Sign In for Pricing
View Details
Bovine Hexokinase ELISA Kit
OM618439 96 Strip Well

Bovine Hexokinase ELISA Kit

Sign In for Pricing
View Details
ECEL1 Protein, Mouse, Recombinant (His & Myc)
TMPH-02641-01 5 µg

ECEL1 Protein, Mouse, Recombinant (His & Myc)

Sign In for Pricing
View Details
ECEL1 Protein, Mouse, Recombinant (His & Myc)
TMPH-02641-02 10 µg

ECEL1 Protein, Mouse, Recombinant (His & Myc)

Sign In for Pricing
View Details
ECEL1 Protein, Mouse, Recombinant (His & Myc)
TMPH-02641-03 20 µg

ECEL1 Protein, Mouse, Recombinant (His & Myc)

Sign In for Pricing
View Details
ECEL1 Protein, Mouse, Recombinant (His & Myc)
TMPH-02641-04 50 µg

ECEL1 Protein, Mouse, Recombinant (His & Myc)

Sign In for Pricing
View Details