Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MGC87631 Peptide - middle region

MGC87631 Peptide - middle region

Product Specifications

UniProt

Q6NUI1

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MGC87631 Rabbit Polyclonal Antibody (orb325908) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001004306

Preservative

Lyophilized powder

AA Sequence

VDKRDRKKSIQQLVPEYKEKQTPESLPQNNNPAAPSQAEGGEGGVACGTV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD63 (NKI-C3), CF740 conjugate, 0.1mg/mL
BNC740186-500 1x 500 µL

CD63 (NKI-C3), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD56 / NCAM (123C3.D5), Biotin conjugate, 0.1mg/mL
BNCB0015-100 1x 100 µL

CD56 / NCAM (123C3.D5), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TMEM248 Polyclonal Antibody
E-AB-52601-01 20 µL

TMEM248 Polyclonal Antibody

Sign In for Pricing
View Details
TMEM248 Polyclonal Antibody
E-AB-52601-02 60 µL

TMEM248 Polyclonal Antibody

Sign In for Pricing
View Details
TMEM248 Polyclonal Antibody
E-AB-52601-03 120 µL

TMEM248 Polyclonal Antibody

Sign In for Pricing
View Details
TMEM248 Polyclonal Antibody
E-AB-52601-04 200 µL

TMEM248 Polyclonal Antibody

Sign In for Pricing
View Details