Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MGLL Peptide - N-terminal region

MGLL Peptide - N-terminal region

Product Specifications

Product Name Alternative

HU-K5, MGL, HUK5, MAGL

UniProt

Q6IBG9

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MGLL Rabbit Polyclonal Antibody (orb330677) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_009214

Preservative

Lyophilized powder

AA Sequence

METGPEDPSSMPEESSPRRTPQSIPYQDLPHLVNADGQYLFCRYWKPTGT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TSPAN18 sgRNA CRISPR Lentivector (Human) (Target 2)
K2542803 1.0 µg DNA

TSPAN18 sgRNA CRISPR Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
CAPN9 Antibody
orb1275608 100 µL

CAPN9 Antibody

Sign In for Pricing
View Details
SH3BGRL2 shRNA (h) Lentiviral Particles
sc-95573-V 200 µL

SH3BGRL2 shRNA (h) Lentiviral Particles

Sign In for Pricing
View Details
TGN46 Antibody
orb431794 0.1 mL

TGN46 Antibody

Sign In for Pricing
View Details
Rabbit Polyclonal KLF2 Antibody
NBP2-31619 0.1 mL

Rabbit Polyclonal KLF2 Antibody

Sign In for Pricing
View Details
ZFYVE27 (NM_001002261) Human Over-expression Lysate
LH03281V 100 µg

ZFYVE27 (NM_001002261) Human Over-expression Lysate

Sign In for Pricing
View Details